PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.MZX0S
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 260aa    MW: 30482.8 Da    PI: 5.6528
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.MZX0SgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-194395456
                 -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 +++f++eq++ Le  Fe+++++  +++ +LA+ lgL+ rqV +WFqNrRa++k
  Aradu.MZX0S 43 KRRFSDEQIRSLECIFESESKLEPRKKIQLARDLGLQPRQVAIWFQNRRARWK 95
                 568*************************************************9 PP

2HD-ZIP_I/II121.44.4e-3941133193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  e+krr+s+eq+++LE  Fe+e+kLep++K +lar+Lglqprqva+WFqnrRAR+k+k++E++y++Lk++yd l+++ e+L+ke+++L+ elk+
  Aradu.MZX0S  41 ENKRRFSDEQIRSLECIFESESKLEPRKKIQLARDLGLQPRQVAIWFQNRRARWKSKRIEQEYRKLKDEYDCLASRFESLKKEKDSLQLELKK 133
                  58**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.84E-183397IPR009057Homeodomain-like
PROSITE profilePS5007117.2973797IPR001356Homeobox domain
SMARTSM003891.2E-1640101IPR001356Homeobox domain
CDDcd000866.20E-154398No hitNo description
Gene3DG3DSA:1.10.10.607.3E-1943104IPR009057Homeodomain-like
PfamPF000465.0E-174395IPR001356Homeobox domain
PRINTSPR000311.4E-56877IPR000047Helix-turn-helix motif
PROSITE patternPS0002707295IPR017970Homeobox, conserved site
PRINTSPR000311.4E-57793IPR000047Helix-turn-helix motif
PfamPF021832.1E-1097138IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MMDGDDEYIQ ASKGKNVESF TCSEVALPQN KNAKKKKSKI ENKRRFSDEQ IRSLECIFES  60
ESKLEPRKKI QLARDLGLQP RQVAIWFQNR RARWKSKRIE QEYRKLKDEY DCLASRFESL  120
KKEKDSLQLE LKKLNDLMVV SASHHDGRRQ EKVIAKGSIT DDGGSGSPHS NWRPNEEEEE  180
AKTSFSNEGV DDDTVPLPSD DKPDEEREHH RHHHHQVMRM DDEEQHLEIP LESLEKWYSE  240
DPSGILDQSC STSQWLDFWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015944671.10.0PREDICTED: homeobox-leucine zipper protein ATHB-12-like
TrEMBLA0A0S3RDW71e-101A0A0S3RDW7_PHAAN; Uncharacterized protein
STRINGGLYMA04G40960.11e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120052635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.14e-43homeobox 7